30-MINUTE MEALS! Get the email series now

Easy Creamy Seafood and Shrimp Chili

5 from 1 vote
1 Comments
Dahabia
By: DahabiaUpdated: Mar 12, 2026
This post may contain affiliate links. Please read our disclosure policy.

A comforting, creamy seafood and shrimp chili that combines tender shrimp, lobster, and crab with beans, corn, and a gentle heat—ready in about 40 minutes.

Easy Creamy Seafood and Shrimp Chili

This creamy seafood and shrimp chili became a weeknight favorite in my kitchen the first time I made it for a blustery evening when guests unexpectedly stayed for dinner. I discovered the balance of savory seafood, soft beans, and a mild chili kick while experimenting with pantry cans and a box of frozen shrimp. The result was warm, satisfying, and elegant enough to share with family, yet simple enough to make on a busy weeknight.

What makes this dish special is the contrast of textures and the melding of flavors: plump shrimp, tender lobster and crab, creamy cheese, and bright tomatoes with chilis. The beans add body and comfort while the corn provides a sweet pop. It’s a great solution when you want the richness of a coastal meal without fuss. Over the years I’ve refined the timing so the seafood stays succulent and doesn’t overcook, and this version is the one everyone asks for at dinner parties and casual gatherings alike.

Why You'll Love This Recipe

  • Ready in roughly 40 minutes from start to finish, making it ideal for busy weeknights or last-minute guests.
  • Uses pantry staples like canned beans and diced tomatoes alongside frozen seafood for an upscale feel with little prep.
  • Protein-rich and filling thanks to shrimp, crab, lobster, and beans—great for family meals or batch cooking.
  • Comforting, creamy texture from cream cheese and shredded cheese without needing heavy cream; the heat is easy to adjust.
  • Flexible: easily doubled, halved, or adapted for dietary needs while keeping delicious seafood flavor.
  • Minimal clean-up when made in a single Dutch oven, saving time on washing multiple pots and pans.

In my experience this dish becomes even better when served with crusty bread or a simple salad. Family members often comment on the tender bits of lobster and crab—they feel like a treat without the long preparation. I’ve learned that seasoning the seafood lightly before adding it to the pot helps maintain bright, distinct flavors even after simmering.

Ingredients

  • Olive oil: 1 teaspoon. Use extra-virgin for flavor; it helps soften the onions without overpowering the seafood.
  • Garlic: 2–3 cloves, minced. Fresh garlic is aromatic and gives a bright foundation—avoid pre-chopped jars for best flavor.
  • Onion: 1 cup chopped (about 1 medium). Yellow onion provides sweetness and depth when sautéed until translucent.
  • Chicken broth: 2 cups low-sodium. Low-sodium allows you to control salt—brands like Swanson or homemade stock work well.
  • Great Northern beans: 1 can (15.5 oz), drained and rinsed. These add creaminess and body without overwhelming the seafood.
  • Black beans: 1 can (15.5 oz), drained and rinsed. Add color, texture, and fiber; rinsing reduces sodium and any canning liquid flavor.
  • Diced tomatoes with chilis: 1 can (15.5 oz), drained. These provide acidity and a subtle heat; choose mild or hot depending on preference.
  • Whole kernel corn: 1/2 cup frozen. Adds sweet crunch—no need to thaw before adding.
  • Shredded cheese: 1 cup Colby and Monterey Jack blend. Melts smoothly to create a creamy finish.
  • Cream cheese: 3 oz. Soften slightly for easier stirring; it builds richness without a heavy dairy punch.
  • Lump crab: 5 oz. Use good-quality canned or fresh lump crab; drain any excess liquid so flavor concentrates.
  • Lobster meat: 5 oz. Pre-cooked lobster works beautifully—chop larger pieces so they distribute through the pot.
  • Shrimp: 1 pound, peeled and deveined. Medium or large shrimp are best; thaw fully and pat dry before seasoning.
  • Seasonings: Seafood seasoning, chili powder, ground cumin, red cayenne pepper, salt, and black pepper—season to taste and adjust heat gradually.

Instructions

Step 1: Sauté onion: Heat 1 teaspoon olive oil in a Dutch oven over medium-high heat until shimmering. Add 1 cup chopped onion and sauté, stirring occasionally, until completely translucent and very soft, about 5–7 minutes. The onion should smell sweet and show no raw bite—this builds a mellow base. Step 2: Add garlic: Reduce heat slightly and stir in 2–3 cloves minced garlic. Cook for 30–45 seconds until fragrant, watching carefully so it does not brown—browned garlic becomes bitter and will change the dish’s flavor. Step 3: Combine liquids and beans: Pour in 2 cups low-sodium chicken broth, the drained Great Northern beans, drained black beans, and drained diced tomatoes with chilis. Stir to combine, scraping up any browned bits from the bottom of the pot. Bring to a gentle simmer over medium heat. Step 4: Simmer gently: Lower heat to medium-low, cover the Dutch oven, and let simmer for 15–20 minutes. This lets flavors marry and softens the beans slightly. Taste the broth and adjust seasoning with salt, chili powder, and cumin at this point. Step 5: Season the seafood: While the base simmers, pat dry the shrimp and toss the shrimp, 5 oz lump crab, and 5 oz lobster meat with seafood seasoning and a pinch of cayenne, salt, and pepper. Light seasoning prevents the seafood from tasting bland after cooking. Step 6: Finish with cheese and seafood: Stir in 1 cup shredded Colby/Monterey Jack, 1/2 cup frozen corn, and 3 oz softened cream cheese into the pot until melted and incorporated. Gently fold in the seasoned crab, lobster, and shrimp. Increase heat to medium and cook uncovered for 5–6 minutes, stirring occasionally, until the shrimp turn pink and opaque and lobster/crab are heated through. Avoid overcooking—shrimp need only a few minutes. User provided content image 1

You Must Know

  • This dish stores well in the refrigerator for up to 3 days in an airtight container and freezes well for about 3 months; thaw overnight in the fridge before reheating.
  • High in protein from shrimp, crab, and lobster, and balanced with fiber from beans—great for a filling weeknight meal.
  • To keep the seafood tender, add it toward the end of cooking and heat just until opaque; overcooking will make shrimp rubbery.
  • Use low-sodium broth and rinse canned beans to control overall saltiness.

One of my favorite things about this pot is how the flavors evolve after a day in the fridge—the spices integrate and the broth becomes even more comforting. Guests often tell me they can taste each type of seafood in every spoonful, which is exactly the effect I aim for when balancing delicate ingredients with robust beans and cheese.

User provided content image 2

Storage Tips

Cool the chili to room temperature within two hours, then transfer to airtight containers. Refrigerate for up to 3 days; reheat gently in a saucepan over low heat, stirring to reincorporate any separated fat. For longer storage, freeze in portioned, freezer-safe containers for up to 3 months. When reheating from frozen, thaw in the refrigerator overnight and reheat slowly to avoid overcooking the seafood. If the chili thickens after refrigeration, add a splash of chicken broth or water to loosen the texture while reheating.

Ingredient Substitutions

If lump crab or lobster is not available, substitute with canned crab meat or additional shrimp—use an extra 8 ounces of shrimp to replace both crab and lobster. For a dairy-free version, omit the shredded cheese and cream cheese and stir in 1/2 cup unsweetened coconut milk and a tablespoon of nutritional yeast for a creamy texture with umami. Replace chicken broth with vegetable stock for a lighter flavor or use a seafood stock to amplify the coastal notes. Swap Colby/Monterey Jack for cheddar for a sharper finish.

Serving Suggestions

Serve this chili in wide bowls with a sprinkle of fresh chopped cilantro or parsley and a wedge of lemon to brighten the flavors. Offer crusty sourdough or cornbread on the side to soak up the creamy broth. For a lower-carb option, serve over a bed of sautéed greens or cauliflower rice. Garnish with extra shredded cheese, sliced scallions, or a drizzle of chili oil for an added kick at the table.

Cultural Background

This dish blends classic coastal seafood traditions with American chili sensibilities—combining shellfish and spicy tomato base is common in coastal communities where seafood is abundant. While not tied to a single regional recipe, the idea of adding beans and corn brings Midwestern comfort elements into a seafood-forward bowl, reflecting a fusion that thrives in home kitchens seeking to marry accessibility with celebratory ingredients.

Seasonal Adaptations

In summer, add fresh corn and cherry tomatoes for brighter flavors; in fall and winter, use full-bodied broth and increase warming spices like smoked paprika and a touch more cayenne. For holiday occasions, stir in a splash of dry white wine with the broth for added depth, or serve in small ramekins as an elegant starter. The recipe scales well for outdoor entertaining or cozy indoor gatherings.

Meal Prep Tips

Prep the base up to two days ahead: cook the onions, garlic, broth, beans, and tomatoes, cool, and refrigerate. When ready to serve, reheat the base and add the cheeses and seafood so the shellfish cooks just until opaque. Portion into microwavable containers for lunches—reheat gently and add a tablespoon of broth to restore creaminess. Label containers with date and contents for easy rotation.

Make this recipe your own by adjusting heat levels, swapping seafood, or adding fresh herbs at the end. It’s a crowd-pleasing, flexible pot that brings warmth and a touch of indulgence to any table—perfect for sharing with good company.

Pro Tips

  • Pat shrimp dry and season just before adding to the pot to ensure a good sear and prevent excess liquid.

  • Use low-sodium broth and taste before adding extra salt; canned ingredients often contain more sodium.

  • Add seafood at the end and cook until just opaque to avoid rubbery shrimp and overcooked lobster.

This nourishing easy creamy seafood and shrimp chili recipe is sure to be a staple in your kitchen. Enjoy every moist, high protein slice — it is perfect for breakfast or as a wholesome snack any time.

FAQs about Recipes

How long will leftovers keep?

Yes. Refrigerate in an airtight container for up to 3 days. Reheat gently on the stove and add a splash of broth if needed.

Can I freeze this chili?

Freeze in portioned containers for up to 3 months. Thaw overnight in the refrigerator before reheating.

Tags

seafooddinnerrecipeschilishrimpcreamyweeknight
No ratings yet

Easy Creamy Seafood and Shrimp Chili

This Easy Creamy Seafood and Shrimp Chili recipe makes perfectly juicy, tender, and flavorful steak every time! Serve with potatoes and a side salad for an unforgettable dinner in under 30 minutes.

Servings: 6 steaks
Easy Creamy Seafood and Shrimp Chili
Prep:15 minutes
Cook:25 minutes
Rest Time:10 mins
Total:40 minutes

Ingredients

Base

Seafood

Dairy & Cheese

Seasonings

Instructions

1

Sauté onion

Heat 1 teaspoon olive oil in a Dutch oven over medium-high heat. Add 1 cup chopped onion and sauté for 5–7 minutes until translucent and soft.

2

Add garlic

Stir in 2–3 cloves minced garlic and cook 30–45 seconds until fragrant, taking care not to brown it.

3

Combine liquids and beans

Add 2 cups low-sodium chicken broth, drained Great Northern beans, drained black beans, and drained diced tomatoes with chilis. Bring to a gentle simmer.

4

Simmer

Lower heat to medium-low, cover, and simmer for 15–20 minutes to let flavors marry. Taste and adjust seasonings.

5

Season seafood

Pat shrimp dry and season shrimp, crab, and lobster lightly with seafood seasoning, a pinch of cayenne, salt, and pepper.

6

Finish with cheese and seafood

Stir in 1 cup shredded cheese, 1/2 cup frozen corn, and 3 oz softened cream cheese until smooth. Add seasoned seafood, increase heat to medium, and cook 5–6 minutes until seafood is opaque and cooked through.

Last Step: Please leave a rating and comment letting us know how you liked this recipe! This helps our business to thrive and continue providing free, high-quality recipes for you.

Nutrition

Calories: 480kcal | Carbohydrates: 36g | Protein:
32g | Fat: 18g | Saturated Fat: 5g |
Polyunsaturated Fat: 4g | Monounsaturated Fat:
7g | Trans Fat: 1g | Cholesterol: 253mg | Sodium:
0mg | Potassium: 953mg | Fiber: 0g | Sugar:
0g | Vitamin A: 577IU | Vitamin C: 3mg | Calcium:
47mg | Iron: 6mg

Did You Make This?

Leave a comment & rating below or tag
@dahabiarecipe on social media!

Easy Creamy Seafood and Shrimp Chili

Categories:

Easy Creamy Seafood and Shrimp Chili

Did You Make This?

Leave a comment & rating below or tag @dahabiarecipe on social media!

Rate This Recipe

Share This Recipe

Enjoyed this recipe? Share it with friends and family, and don't forget to leave a review!

Comments (1)

Leave a Comment

0/1000 characters
Food Lover
1 day ago

This recipe looks amazing! Can't wait to try it.

Rating:

Comments are stored locally in your browser. Server comments are displayed alongside your local comments.

Family photo

Hi, I'm Dahabia!

Chef and recipe creator specializing in delicious home cooking. Passionate about sharing easy-to-follow recipes that bring families together around the dinner table.

30-Minute Meals!

Join to receive our email series which contains a round-up of some of our quick and easy family favorite recipes.